The Economist: Finance and economics RSS feed analytics

Finance and economics

https://www.economist.com/finance-and-economics/rss.xml
Finance and investing RSS or Atom
Follow in Inoreader Claim this feed Check another feed
Top 1%of finance and investing feeds
25kreaders in Inoreader
6.3posts a week
10 minutescheck interval

Audience

Readers since 2014, against other finance and investing feeds in Inoreader

Top 1% of finance and investing feeds in Inoreader

About the same place as a year ago.

2014201620182020202220242026
This feed Median Middle half Top 25% to 10% Top 10% to 1%

Publishing schedule

27 posts reached Inoreader in the last 30 days. Most posts arrive on weekdays in the morning, UTC.

00:0006:0012:0018:0023:00

Time zone: UTC

Posts per day (30 days)

Delivery

48h success rate
100%
Median response time
under 0.1 s
Not modified (304)
99%
Check interval
10 minutes
Real-time delivery
No
Full report in the feed validator

Topics

financeeconomicsmarketinginvestingwirtschaftmoneyfinanzasfinanza

Readers also follow

More feeds from economist.com

Publisher analytics

Claim the feed with a code in the feed or on the site's domain and see the full subscriber history with the follows and unfollows of every week, which posts readers save, like, share and highlight, where new readers came from, 30 days of delivery checks, email alerts when the feed breaks, CSV downloads, and tips that make the feed look better in Inoreader. It is free.

Claim this feed

Request removal